Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200164_WB13.jpg WB (Western Blot) (WB Suggested Anti-MYCNOS AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit anti-Human MYCNOS Polyclonal Antibody | anti-MYCNOS antibody

MYCNOS antibody - N-terminal region

Gene Names
MYCNOS; NCYM; NYCM; N-CYM; MYCN-AS1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYCNOS, Antibody; MYCNOS antibody - N-terminal region; anti-MYCNOS antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WGGETDASNPAPALTACCAAEREANVEQGLAGRLLLCNYERRLVRRCKIA
Sequence Length
109
Applicable Applications for anti-MYCNOS antibody
WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MYCNOS AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

product-image-AAA200164_WB13.jpg WB (Western Blot) (WB Suggested Anti-MYCNOS AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: MYCNOSSample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200164_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MYCNOSSample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MYCNOS antibody
This is a rabbit polyclonal antibody against MYCNOS. It was validated on Western Blot

Target Description: The N-myc oncogene has been implicated in the pathogenesis of a number of human tumors, including childhood neuroblastoma and adult small cell lung cancer. Complementary DNA clones derived from a transcription unit, N-cym, located on the opposite DNA strand to N-myc have been characterized. There is extensive overlap between the 5' ends of the two transcription units. The N-cym gene, which can encode a 109-amino acid protein, is expressed during fetal development, as well as in tumor cell lines containing amplified N-myc loci, where it is expressed at very high levels. Although other examples of overlapping, opposite-strand eukaryotic genes exist, N-myc and N-cym are unique in that they appear to be coregulated in tumor cell lines under basal growth conditions and in response to the differentiating agent retinoic acid. This coregulation suggests that their protein products may be functionally interrelated during normal development and oncogenesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
N-cym protein
NCBI Official Synonym Full Names
MYCN opposite strand
NCBI Official Symbol
MYCNOS
NCBI Official Synonym Symbols
NCYM; NYCM; N-CYM; MYCN-AS1
NCBI Protein Information
N-cym protein
UniProt Protein Name
N-cym protein
UniProt Gene Name
MYCNOS
UniProt Synonym Gene Names
CYMN; NCYM
UniProt Entry Name
NCYM_HUMAN

Similar Products

Product Notes

The MYCNOS mycnos (Catalog #AAA200164) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYCNOS antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYCNOS can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MYCNOS mycnos for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WGGETDASNP APALTACCAA EREANVEQGL AGRLLLCNYE RRLVRRCKIA. It is sometimes possible for the material contained within the vial of "MYCNOS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.