Rabbit Myostatin (MSTN) Polyclonal Antibody | anti-MSTN antibody
Polyclonal Antibody to Myostatin (MSTN)
Gene Names
MSTN; GDF8; MSLHP
Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry
Purity
Affinity Chromatography
Synonyms
Myostatin (MSTN), Antibody; Polyclonal Antibody to Myostatin (MSTN); anti-MSTN antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against MSTN. It has been selected for its ability to recognize MSTN in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with N-terminal His-Tag and its sequence is listed below.
MGHHHHHHSGSEF-RDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
MGHHHHHHSGSEF-RDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Sequence Length
126
Applicable Applications for anti-MSTN antibody
WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry)
Immunogen
Recombinant MSTN (Arg266~Ser375) expressed in E.coli.
Cross Reactivity
Human
Conjugated Antibody
The APC conjugated antibody version of this item is also available as
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,750 Da
NCBI Official Full Name
growth/differentiation factor 8 preproprotein
NCBI Official Synonym Full Names
myostatin
NCBI Official Symbol
MSTN
NCBI Official Synonym Symbols
GDF8; MSLHP
NCBI Protein Information
growth/differentiation factor 8
UniProt Protein Name
Growth/differentiation factor 8
UniProt Gene Name
MSTN
UniProt Synonym Gene Names
GDF8; GDF-8
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MSTN mstn (Catalog #AAA132286) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Myostatin (MSTN) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Myostatin (MSTN) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry). Researchers should empirically determine the suitability of the MSTN mstn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with N-terminal His-Tag and its sequence is listed below. MGHHHHHHSG SEF-RDFGLD CDEHSTESRC CRYPLTVDFE AFGWDWIIAP KRYKANYCSG ECEFVFLQKY PHTHLVHQAN PRGSAGPCCT PTKMSPINML YFNGKEQIIY GKIPAMVVDR CGCS. It is sometimes possible for the material contained within the vial of "Myostatin (MSTN), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
