Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46752_IHC13.jpg IHC (Immunohiostchemistry) (NARG1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- NARG1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit anti-Human, Mouse NARG1 Polyclonal Antibody | anti-NAA15 antibody

Anti-NARG1 Antibody

Average rating 0.0
No ratings yet
Gene Names
NAA15; Ga19; NATH; TBDN; NARG1; NAT1P; TBDN100
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
NARG1, Antibody; Anti-NARG1 Antibody; ASTBDN; GA19; mNAT1; Naa15; NATH; Tbdn 1; Tbdn100; tubedown-1; Q9BXJ9; N-alpha-acetyltransferase 15, NatA auxiliary subunit; anti-NAA15 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
866
Applicable Applications for anti-NAA15 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(NARG1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- NARG1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46752_IHC13.jpg IHC (Immunohiostchemistry) (NARG1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- NARG1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of NARG1 expression in 293T whole cell lysates (lane 1). NARG1 at 101KD was detected using rabbit anti- NARG1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46752_WB15.jpg WB (Western Blot) (Western blot analysis of NARG1 expression in 293T whole cell lysates (lane 1). NARG1 at 101KD was detected using rabbit anti- NARG1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-NAA15 antibody
Rabbit IgG polyclonal antibody for N-alpha-acetyltransferase 15, NatA auxiliary subunit(NAA15) detection.
Background: NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (Nalpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.
References
1. Arnesen, T., Anderson, D., Baldersheim, C., Lanotte, M., Varhaug, J. E., Lillehaug, J. R. Identification and characterization of the human ARD1-NATH protein acetyltransferase complex. Biochem. J. 386: 433-443, 2005.
2. Fluge, O., Bruland, O., Akslen, L. A., Varhaug, J. E., Lillehaug, J. R. NATH, a novel gene overexpressed in papillary thyroid carcinomas. Oncogene 21: 5056-5068, 2002.
3. Sugiura, N., Patel, R. G., Corriveau, R. A. N-methyl-D-aspartate receptors regulate a group of transiently expressed genes in the developing brain. J. Biol. Chem. 276: 14257-14263, 2001.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,602 Da
NCBI Official Full Name
N-alpha-acetyltransferase 15, NatA auxiliary subunit
NCBI Official Synonym Full Names
N(alpha)-acetyltransferase 15, NatA auxiliary subunit
NCBI Official Symbol
NAA15
NCBI Official Synonym Symbols
Ga19; NATH; TBDN; NARG1; NAT1P; TBDN100
NCBI Protein Information
N-alpha-acetyltransferase 15, NatA auxiliary subunit
UniProt Protein Name
N-alpha-acetyltransferase 15, NatA auxiliary subunit
UniProt Gene Name
NAA15
UniProt Synonym Gene Names
GA19; NARG1; NATH; TBDN100

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NAA15 naa15 (Catalog #AAA46752) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-NARG1 Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NARG1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NAA15 naa15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NARG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.