Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197381_WB11.jpg WB (Western Blot) (WB Suggested Anti-NCOA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Rabbit NCOA3 Polyclonal Antibody | anti-NCOA3 antibody

NCOA3 antibody - middle region

Gene Names
NCOA3; ACTR; AIB1; RAC3; SRC3; pCIP; AIB-1; CTG26; SRC-3; CAGH16; KAT13B; TNRC14; TNRC16; TRAM-1; bHLHe42
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NCOA3, Antibody; NCOA3 antibody - middle region; anti-NCOA3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLL
Sequence Length
1420
Applicable Applications for anti-NCOA3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 77%; Dog: 90%; Horse: 92%; Human: 100%; Mouse: 83%; Pig: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NCOA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NCOA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

product-image-AAA197381_WB11.jpg WB (Western Blot) (WB Suggested Anti-NCOA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: NCOA3Sample Type: MCF7Antibody Dilution: 1.0ug/mlNCOA3 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

product-image-AAA197381_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: NCOA3Sample Type: MCF7Antibody Dilution: 1.0ug/mlNCOA3 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0ug/ml using anti-NCOA3 antibody)

product-image-AAA197381_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0ug/ml using anti-NCOA3 antibody)
Related Product Information for anti-NCOA3 antibody
This is a rabbit polyclonal antibody against NCOA3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NCOA3 is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
155kDa
NCBI Official Full Name
nuclear receptor coactivator 3 isoform b
NCBI Official Synonym Full Names
nuclear receptor coactivator 3
NCBI Official Symbol
NCOA3
NCBI Official Synonym Symbols
ACTR; AIB1; RAC3; SRC3; pCIP; AIB-1; CTG26; SRC-3; CAGH16; KAT13B; TNRC14; TNRC16; TRAM-1; bHLHe42
NCBI Protein Information
nuclear receptor coactivator 3

Similar Products

Product Notes

The NCOA3 (Catalog #AAA197381) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCOA3 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NCOA3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NCOA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQNPVESSMC QSNSRDHLSD KESKESSVEG AENQRGPLES KGHKKLLQLL. It is sometimes possible for the material contained within the vial of "NCOA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.