Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281627_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using NDRG4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit NDRG4 Polyclonal Antibody | anti-NDRG4 antibody

NDRG4 Rabbit pAb

Gene Names
NDRG4; BDM1; SMAP8; SMAP-8
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
NDRG4, Antibody; NDRG4 Rabbit pAb; NDRG4; BDM1; SMAP-8; SMAP8; anti-NDRG4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
DPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVP
Applicable Applications for anti-NDRG4 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human NDRG4 (NP_001229765.1).
Cellular Location
Cytoplasm, cytosol
Positive Samples
Mouse brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using NDRG4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281627_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using NDRG4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using NDRG4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281627_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using NDRG4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using NDRG4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281627_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using NDRG4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using NDRG4 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281627_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NDRG4 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-NDRG4 antibody
Background: This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,459 Da
NCBI Official Full Name
protein NDRG4 isoform 2
NCBI Official Synonym Full Names
NDRG family member 4
NCBI Official Symbol
NDRG4
NCBI Official Synonym Symbols
BDM1; SMAP8; SMAP-8
NCBI Protein Information
protein NDRG4; smooth muscle-associated protein 8; brain development-related molecule 1; N-myc downstream-regulated gene 4 protein; vascular smooth muscle cell-associated protein 8
UniProt Protein Name
Protein NDRG4
UniProt Gene Name
NDRG4
UniProt Synonym Gene Names
BDM1; KIAA1180; SMAP-8
UniProt Entry Name
NDRG4_HUMAN

Similar Products

Product Notes

The NDRG4 ndrg4 (Catalog #AAA281627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDRG4 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NDRG4 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the NDRG4 ndrg4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DPNGKGWIDW AATKLSGLTS TLPDTVLSHL FSQEELVNNT ELVQSYRQQI GNVVNQANLQ LFWNMYNSRR DLDINRPGTV P. It is sometimes possible for the material contained within the vial of "NDRG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.