Rabbit anti-Human NDUFA13 Polyclonal Antibody | anti-NDUFA13 antibody
NDUFA13 Antibody - N-terminal region
Gene Names
NDUFA13; B16.6; CDA016; CGI-39; GRIM19; GRIM-19; MC1DN28
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NDUFA13, Antibody; NDUFA13 Antibody - N-terminal region; anti-NDUFA13 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRR
Sequence Length
144
Applicable Applications for anti-NDUFA13 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUAD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-NDUFA13 antibody
This is a rabbit polyclonal antibody against NDUAD. It was validated on Western Blot
Target Description: This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.
Target Description: This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.
Product Categories/Family for anti-NDUFA13 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit A13
NCBI Official Symbol
NDUFA13
NCBI Official Synonym Symbols
B16.6; CDA016; CGI-39; GRIM19; GRIM-19; MC1DN28
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
UniProt Gene Name
NDUFA13
UniProt Synonym Gene Names
GRIM19; CI-B16.6; GRIM-19; Gene associated with retinoic and IFN-induced mortality 19 protein
UniProt Entry Name
NDUAD_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The NDUFA13 ndufa13 (Catalog #AAA201533) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFA13 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA13 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NDUFA13 ndufa13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPPPGGYGPI DYKRNLPRRG LSGYSMLAIG IGTLIYGHWS IMKWNRERRR. It is sometimes possible for the material contained within the vial of "NDUFA13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
