Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281204_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NDUFA4L2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

Rabbit NDUFA4L2 Polyclonal Antibody | anti-NDUFA4L2 antibody

NDUFA4L2 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
NDUFA4L2; NUOMS
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NDUFA4L2, Antibody; NDUFA4L2 Polyclonal Antibody; NUOMS; anti-NDUFA4L2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF
Sequence Length
87
Applicable Applications for anti-NDUFA4L2 antibody
WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human NDUFA4L2 (NP_064527.1).
Immunogen Species
Human
Category
Polyclonal Antibodies
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
293T, Jurkat, HepG2, HeLa, Mouse brain, Mouse kidney, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using NDUFA4L2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA281204_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NDUFA4L2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Product Categories/Family for anti-NDUFA4L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 9kDa
Observed: 12kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NDUFA4, mitochondrial complex associated like 2
NCBI Official Symbol
NDUFA4L2
NCBI Official Synonym Symbols
NUOMS
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
UniProt Gene Name
NDUFA4L2
UniProt Synonym Gene Names
NUOMS

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NDUFA4L2 ndufa4l2 (Catalog #AAA281204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFA4L2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA4L2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NDUFA4L2 ndufa4l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGASLGARF YRQIKRHPGI IPMIGLICLG MGSAALYLLR LALRSPDVCW DRKNNPEPWN RLSPNDQYKF LAVSTDYKKL KKDRPDF. It is sometimes possible for the material contained within the vial of "NDUFA4L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.