IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] NDUFS5 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
Rabbit anti-Human NDUFS5 Polyclonal Antibody | anti-NDUFS5 antibody
NDUFS5 Rabbit pAb
Gene Names
PROM1; RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
NDUFS5, Antibody; NDUFS5 Rabbit pAb; NDUFS5; CI-15k; CI15K; NADH:ubiquinone oxidoreductase subunit S5; anti-NDUFS5 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
ANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSY
Applicable Applications for anti-NDUFS5 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1).
Cellular Location
Mitochondrion, Mitochondrion inner membrane, Mitochondrion intermembrane space, Peripheral membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] NDUFS5 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] NDUFS5 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using NDUFS5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using NDUFS5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-NDUFS5 antibody
This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17.
Product Categories/Family for anti-NDUFS5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
97kDa
NCBI Official Full Name
Prominin-1
NCBI Official Synonym Full Names
prominin 1
NCBI Official Symbol
PROM1
NCBI Official Synonym Symbols
RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061
NCBI Protein Information
prominin-1; hProminin; antigen AC133; prominin-like protein 1; hematopoietic stem cell antigen
UniProt Protein Name
Prominin-1
UniProt Gene Name
PROM1
UniProt Synonym Gene Names
PROML1
UniProt Entry Name
PROM1_HUMAN
Similar Products
Product Notes
The NDUFS5 prom1 (Catalog #AAA282273) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFS5 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFS5 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the NDUFS5 prom1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ANHQVRTRIK RSRKLADSNF KDLRTLLNET PEQIKYILAQ YNTTKDKAFT DLNSINSVLG GGILDRLRPN IIPVLDEIKS MATAIKETKE ALENMNSTLK SLHQQSTQLS SSLTSVKTSL RSSLNDPLCL VHPSSETCNS IRLSLSQLNS NPELRQLPPV DAELDNVNNV LRTDLDGLVQ QGYQSLNDIP DRVQRQTTTV VAGIKRVLNS IGSDIDNVTQ RLPIQDILSA FSVYVNNTES YIHRNLPTLE EYDSY. It is sometimes possible for the material contained within the vial of "NDUFS5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.