WB (Western Blot)
(WB Suggested Anti-NDUFV1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Rabbit NDUFV1 Polyclonal Antibody | anti-NDUFV1 antibody
NDUFV1 antibody - N-terminal region
Gene Names
NDUFV1; UQOR1; CI-51K; CI51KD; MC1DN4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
NDUFV1, Antibody; NDUFV1 antibody - N-terminal region; anti-NDUFV1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG
Sequence Length
464
Applicable Applications for anti-NDUFV1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NDUFV1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NDUFV1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-NDUFV1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: NDUFV1Sample Type: Fetal lung Cell lysatesAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NDUFV1Sample Type: Fetal lung Cell lysatesAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NDUFV1Sample Type: Fetal liver Cell lysatesAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NDUFV1Sample Type: Fetal liver Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NDUFV1 antibody
This is a rabbit polyclonal antibody against NDUFV1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-NDUFV1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase core subunit V1
NCBI Official Symbol
NDUFV1
NCBI Official Synonym Symbols
UQOR1; CI-51K; CI51KD; MC1DN4
NCBI Protein Information
NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
UniProt Gene Name
NDUFV1
UniProt Synonym Gene Names
UQOR1; CI-51kD
UniProt Entry Name
NDUV1_HUMAN
Similar Products
Product Notes
The NDUFV1 ndufv1 (Catalog #AAA199912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFV1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFV1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NDUFV1 ndufv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FMNKPSDGRP KYLVVNADEG EPGTCKDREI LRHDPHKLLE GCLVGGRAMG. It is sometimes possible for the material contained within the vial of "NDUFV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.