Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199964_WB8.jpg WB (Western Blot) (WB Suggested Anti-NEK11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateNEK11 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit NEK11 Polyclonal Antibody | anti-NEK11 antibody

NEK11 antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Cow, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NEK11, Antibody; NEK11 antibody - middle region; anti-NEK11 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS
Sequence Length
645
Applicable Applications for anti-NEK11 antibody
WB (Western Blot)
Homology
Cow: 77%; Horse: 100%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NEK11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NEK11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateNEK11 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA199964_WB8.jpg WB (Western Blot) (WB Suggested Anti-NEK11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateNEK11 is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: NEK11Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA199964_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: NEK11Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NEK11Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199964_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: NEK11Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NEK11Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199964_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: NEK11Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NEK11Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA199964_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: NEK11Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NEK11 antibody
This is a rabbit polyclonal antibody against NEK11. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses (Noguchi et al., 2002 [PubMed 12154088]).[supplied by OMIM]. Sequence Note: removed 2 bases from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2937 AB071996.1 1-2937

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
serine/threonine-protein kinase Nek11 isoform 3
NCBI Official Synonym Full Names
NIMA related kinase 11
NCBI Official Symbol
NEK11
NCBI Protein Information
serine/threonine-protein kinase Nek11
UniProt Protein Name
Serine/threonine-protein kinase Nek11
UniProt Gene Name
NEK11
UniProt Synonym Gene Names
NimA-related protein kinase 11
UniProt Entry Name
NEK11_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NEK11 nek11 (Catalog #AAA199964) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEK11 antibody - middle region reacts with Cow, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NEK11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NEK11 nek11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEIRNEGSQP AYRTNQQDSD IEALARCLEN VLGCTSLDTK TITTMAEDMS. It is sometimes possible for the material contained within the vial of "NEK11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.