<
WB (Western Blot)
(WB Suggested Anti-NES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
Rabbit NES Polyclonal Antibody | anti-NES antibody
NES antibody - middle region
Gene Names
NES; Nbla00170
Reactivity
Tested Species Reactivity: Human, MousePredicted Species Reactivity: Human, Mouse, Cow, Dog, Horse, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NES, Antibody; NES antibody - middle region; anti-NES antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Human, Mouse, Cow, Dog, Horse, Pig
Predicted Species Reactivity: Human, Mouse, Cow, Dog, Horse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
Sequence Length
1621
Applicable Applications for anti-NES antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NES
Protein Size (# AA)
1621 amino acids
Protein Interactions
SUMO3; UBC; SIRT7; CDK5R1; CDK5; SRRM1; CDK1;
Blocking Peptide
For anti-NES (MBS3214051) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
WB (Western Blot)
(WB Suggested Anti-NES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
WB (Western Blot)
(WB Suggested Anti-NES AntibodyPositive Control: Lane1: 25ug mouse NIH3T3 lysate, Lane2: 25ug mouse embryonic stem cell lysate, Lane3: 25ug mouse neural stem cell lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:3000Submitted by: Domenico Maiorano, Institute of Human Genetics, CNRS)
WB (Western Blot)
(WB Suggested Anti-NES AntibodyPositive Control: Lane1: 25ug mouse NIH3T3 lysate, Lane2: 25ug mouse embryonic stem cell lysate, Lane3: 25ug mouse neural stem cell lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:3000Submitted by: Domenico Maiorano, Institute of Human Genetics, CNRS)
WB (Western Blot)
(Host: RabbitTarget Name: NESSample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NESSample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Heart)
IHC (Immunohistochemistry)
(Heart)
Related Product Information for anti-NES antibody
Target Description: Nestin is an intermediate filament protein that was first identified with a monoclonal antibody by Hockfield and McKay (1985) [PubMed 4078630]. It is expressed predominantly in stem cells of the central nervous system in the neural tube. Upon terminal neu
Product Categories/Family for anti-NES antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
177kDa
NCBI Official Full Name
nestin
NCBI Official Synonym Full Names
nestin
NCBI Official Symbol
NES
NCBI Official Synonym Symbols
Nbla00170
NCBI Protein Information
nestin
UniProt Protein Name
Nestin
UniProt Gene Name
NES
UniProt Entry Name
NEST_HUMAN
Similar Products
Product Notes
The NES nes (Catalog #AAA200859) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NES antibody - middle region reacts with Tested Species Reactivity: Human, Mouse Predicted Species Reactivity: Human, Mouse, Cow, Dog, Horse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's NES can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NES nes for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPDSTPLGFY LRSPTSPRWD PTGEQRPPPQ GETGKEGWDP AVLASEGLEA. It is sometimes possible for the material contained within the vial of "NES, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.