Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46333_IHC11.jpg IHC (Immunohistochemisry) (Anti- Neuropeptide Y Picoband antibody, AAA46333,IHC(P)IHC(P): Rat Brain Tissue)

Neuropeptide Y Polyclonal Antibody | anti-NPY antibody

Anti-Neuropeptide Y Antibody

Gene Names
NPY; PYY4
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Neuropeptide Y, Antibody; Anti-Neuropeptide Y Antibody; Pro-neuropeptide Y; C-flanking peptide of NPY; CPON; Neuropeptide tyrosine; Neuropeptide Y precursor; NPY; NPY_HUMAN; Pro neuropeptide Y; PYY 4; PYY4; Y Neuropeptide antibody; neuropeptide Y; anti-NPY antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
97
Applicable Applications for anti-NPY antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- Neuropeptide Y Picoband antibody, AAA46333,IHC(P)IHC(P): Rat Brain Tissue)

product-image-AAA46333_IHC11.jpg IHC (Immunohistochemisry) (Anti- Neuropeptide Y Picoband antibody, AAA46333,IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohiostchemistry)

(Anti- Neuropeptide Y Picoband antibody, AAA46333,IHC(P)IHC(P): Mouse Brain Tissue)

product-image-AAA46333_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Neuropeptide Y Picoband antibody, AAA46333,IHC(P)IHC(P): Mouse Brain Tissue)

Application Data

(All lanes: Anti Neuropeptide Y (AAA46333) at 0.5ug/mlWB: Recombinant Human Neuropeptide Y Protein 0.5ngPredicted bind size: 11KDObserved bind size: 11KD)

product-image-AAA46333_AD15.jpg Application Data (All lanes: Anti Neuropeptide Y (AAA46333) at 0.5ug/mlWB: Recombinant Human Neuropeptide Y Protein 0.5ngPredicted bind size: 11KDObserved bind size: 11KD)
Related Product Information for anti-NPY antibody
Background: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.
References
1. Benarroch, E. E. Neuropeptide Y: its multiple effects in the CNS and potential clinical significance. Neurology 72: 1016-1020, 2009. 2. Lee, E. W., Michalkiewicz, M., Kitlinska, J., Kalezic, I., Switalska, H., Yoo, P., Sangkharat, A., Ji, H., Li, L., Michalkiewicz, T., Ljubisavljevic, M., Johansson, H., Grant, D. S., Zukowska, Z. Neuropeptide Y induces ischemic angiogenesis and restores function of ischemic skeletal muscles. J. Clin. Invest. 111: 1853-1862, 2003.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
pro-neuropeptide Y preproprotein
NCBI Official Synonym Full Names
neuropeptide Y
NCBI Official Symbol
NPY
NCBI Official Synonym Symbols
PYY4
NCBI Protein Information
pro-neuropeptide Y
UniProt Protein Name
Pro-neuropeptide Y
UniProt Gene Name
NPY
UniProt Synonym Gene Names
NPY; CPON
UniProt Entry Name
NPY_HUMAN

Similar Products

Product Notes

The NPY npy (Catalog #AAA46333) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Neuropeptide Y Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Neuropeptide Y can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NPY npy for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Neuropeptide Y, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.