WB (Western Blot)
(WB Suggested Anti-NFE2L1 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Rabbit NFE2L1 Polyclonal Antibody | anti-NFE2L1 antibody
NFE2L1 antibody - C-terminal region
Gene Names
NFE2L1; NRF1; TCF11; LCR-F1
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NFE2L1, Antibody; NFE2L1 antibody - C-terminal region; anti-NFE2L1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP
Sequence Length
772
Applicable Applications for anti-NFE2L1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NFE2L1 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
WB (Western Blot)
(WB Suggested Anti-NFE2L1 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
WB (Western Blot)
(Host: RabbitTarget Name: NFE2L1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NFE2L1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-NFE2L1 antibody
This is a rabbit polyclonal antibody against NFE2L1. It was validated on Western Blot
Target Description: NFE2L1 activates erythroid-specific, globin gene expression.
Target Description: NFE2L1 activates erythroid-specific, globin gene expression.
Product Categories/Family for anti-NFE2L1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
endoplasmic reticulum membrane sensor NFE2L1 isoform 1
NCBI Official Synonym Full Names
nuclear factor, erythroid 2 like 1
NCBI Official Symbol
NFE2L1
NCBI Official Synonym Symbols
NRF1; TCF11; LCR-F1
NCBI Protein Information
endoplasmic reticulum membrane sensor NFE2L1
UniProt Protein Name
Nuclear factor erythroid 2-related factor 1
UniProt Gene Name
NFE2L1
UniProt Synonym Gene Names
HBZ17; NRF1; TCF11; NF-E2-related factor 1; NFE2-related factor 1; TCF-11
UniProt Entry Name
NF2L1_HUMAN
Similar Products
Product Notes
The NFE2L1 nfe2l1 (Catalog #AAA197135) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFE2L1 antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFE2L1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NFE2L1 nfe2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HTYNMAPSAL DSADLPPPSA LKKGSKEKQA DFLDKQMSRD EHRARAMKIP. It is sometimes possible for the material contained within the vial of "NFE2L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.