WB (Western Blot)
(WB Suggested Anti-NFKBIE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)
Rabbit NFKBIE Polyclonal Antibody | anti-NFKBIE antibody
NFKBIE antibody - middle region
Gene Names
NFKBIE; IKBE
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NFKBIE, Antibody; NFKBIE antibody - middle region; anti-NFKBIE antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
Sequence Length
500
Applicable Applications for anti-NFKBIE antibody
WB (Western Blot)
Homology
Cow: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NFKBIE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NFKBIE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)
WB (Western Blot)
(WB Suggested Anti-NFKBIE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)
WB (Western Blot)
(Host: MouseTarget Name: NFKBIESample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: NFKBIESample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-NFKBIE antibody
This is a rabbit polyclonal antibody against NFKBIE. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-ka
Target Description: NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-ka
Product Categories/Family for anti-NFKBIE antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
NF-kappa-B inhibitor epsilon
NCBI Official Synonym Full Names
NFKB inhibitor epsilon
NCBI Official Symbol
NFKBIE
NCBI Official Synonym Symbols
IKBE
NCBI Protein Information
NF-kappa-B inhibitor epsilon
UniProt Protein Name
NF-kappa-B inhibitor epsilon
UniProt Gene Name
NFKBIE
UniProt Synonym Gene Names
IKBE; NF-kappa-BIE; IkB-E; IkB-epsilon
UniProt Entry Name
IKBE_HUMAN
Similar Products
Product Notes
The NFKBIE nfkbie (Catalog #AAA198328) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKBIE antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFKBIE can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NFKBIE nfkbie for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DARMLNGCTP LHLAAGRGLM GISSTLCKAG ADSLLRNVED ETPQDLTEES. It is sometimes possible for the material contained within the vial of "NFKBIE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.