Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281042_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using NFS1 antibody. Blue: DAPI for nuclear staining.)

Rabbit NFS1 Polyclonal Antibody | anti-NFS1 antibody

NFS1 Polyclonal Antibody

Gene Names
NFS1; IscS; NIFS; HUSSY-08
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
NFS1, Antibody; NFS1 Polyclonal Antibody; HUSSY-08; IscS; NIFS; anti-NFS1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKIPLDVNDMKIDLMSISGHKIYGPKGVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSFAYVEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVDYTVEKCIQHVKRLREMSPLWEMVQDGIDLKSIKWTQH
Sequence Length
406
Applicable Applications for anti-NFS1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human NFS1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Mitochondrion, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using NFS1 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281042_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using NFS1 antibody. Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human liver cancer using NFS1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281042_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using NFS1 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using NFS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)

product-image-AAA281042_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NFS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)
Related Product Information for anti-NFS1 antibody
Iron-sulfur clusters are required for the function of many cellular enzymes. The proteins encoded by this gene supply inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH. The encoded proteins belong to the class-V family of pyridoxal phosphate-dependent aminotransferases. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-NFS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 44kDa; 50kDa
Observed: 50kDa
NCBI Official Full Name
cysteine desulfurase, mitochondrial isoform b
NCBI Official Synonym Full Names
NFS1, cysteine desulfurase
NCBI Official Symbol
NFS1
NCBI Official Synonym Symbols
IscS; NIFS; HUSSY-08
NCBI Protein Information
cysteine desulfurase, mitochondrial
UniProt Protein Name
Cysteine desulfurase, mitochondrial
UniProt Gene Name
NFS1
UniProt Synonym Gene Names
NIFS

Similar Products

Product Notes

The NFS1 nfs1 (Catalog #AAA281042) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFS1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFS1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NFS1 nfs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EIGVKQPIAE IGRICSSRKV YFHTDAAQAV GKIPLDVNDM KIDLMSISGH KIYGPKGVGA IYIRRRPRVR VEALQSGGGQ ERGMRSGTVP TPLVVGLGAA CEVAQQEMEY DHKRISKLSE RLIQNIMKSL PDVVMNGDPK HHYPGCINLS FAYVEGESLL MALKDVALSS GSACTSASLE PSYVLRAIGT DEDLAHSSIR FGIGRFTTEE EVDYTVEKCI QHVKRLREMS PLWEMVQDGI DLKSIKWTQH. It is sometimes possible for the material contained within the vial of "NFS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.