Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281163_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using NGF antibody at dilution of 1:75 (40x lens).)

Rabbit NGF Polyclonal Antibody | anti-NGF antibody

NGF Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
NGF; NGFB; HSAN5; Beta-NGF
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
NGF, Antibody; NGF Polyclonal Antibody; Beta-NGF; HSAN5; NGFB; anti-NGF antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Sequence Length
241
Applicable Applications for anti-NGF antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human NGF
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using NGF antibody at dilution of 1:75 (40x lens).)

product-image-AAA281163_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using NGF antibody at dilution of 1:75 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse brain using NGF antibody at dilution of 1:75 (40x lens).)

product-image-AAA281163_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse brain using NGF antibody at dilution of 1:75 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat brain using NGF antibody at dilution of 1:75 (40x lens).)

product-image-AAA281163_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat brain using NGF antibody at dilution of 1:75 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of mouse heart, using NGF antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281163_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of mouse heart, using NGF antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-NGF antibody
This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis.
Product Categories/Family for anti-NGF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 26kDa
Observed: 26kDa
NCBI Official Full Name
beta-nerve growth factor
NCBI Official Synonym Full Names
nerve growth factor
NCBI Official Symbol
NGF
NCBI Official Synonym Symbols
NGFB; HSAN5; Beta-NGF
NCBI Protein Information
beta-nerve growth factor
UniProt Protein Name
Beta-nerve growth factor
UniProt Gene Name
NGF
UniProt Synonym Gene Names
NGFB; Beta-NGF

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NGF ngf (Catalog #AAA281163) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NGF Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NGF can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NGF ngf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EPHSESNVPA GHTIPQAHWT KLQHSLDTAL RRARSAPAAA IAARVAGQTR NITVDPRLFK KRRLRSPRVL FSTQPPREAA DTQDLDFEVG GAAPFNRTHR SKRSSSHPIF HRGEFSVCDS VSVWVGDKTT ATDIKGKEVM VLGEVNINNS VFKQYFFETK CRDPNPVDSG CRGIDSKHWN SYCTTTHTFV KALTMDGKQA AWRFIRIDTA CVCVLSRKAV RRA. It is sometimes possible for the material contained within the vial of "NGF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.