WB (Western Blot)
(WB Suggested Anti-NKD1 AntibodyTitration: 1 ug/mlPositive Control: HepG2 cell lysate)
Rabbit NKD1 Polyclonal Antibody | anti-NKD1 antibody
NKD1 antibody - N-terminal region
Gene Names
NKD1; Naked1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NKD1, Antibody; NKD1 antibody - N-terminal region; anti-NKD1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG
Sequence Length
470
Applicable Applications for anti-NKD1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 85%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NKD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NKD1 AntibodyTitration: 1 ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-NKD1 AntibodyTitration: 1 ug/mlPositive Control: HepG2 cell lysate)
IHC (Immunohistochemistry)
(Rabbit Anti-NKD1 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-NKD1 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-NKD1 antibody
This is a rabbit polyclonal antibody against NKD1. It was validated on Western Blot and immunohistochemistry
Target Description: In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM].
Target Description: In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM].
Product Categories/Family for anti-NKD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
protein naked cuticle homolog 1
NCBI Official Synonym Full Names
NKD inhibitor of WNT signaling pathway 1
NCBI Official Symbol
NKD1
NCBI Official Synonym Symbols
Naked1
NCBI Protein Information
protein naked cuticle homolog 1
UniProt Protein Name
Protein naked cuticle homolog 1
UniProt Gene Name
NKD1
UniProt Synonym Gene Names
NKD; Naked-1; hNkd; hNkd1
UniProt Entry Name
NKD1_HUMAN
Similar Products
Product Notes
The NKD1 nkd1 (Catalog #AAA198860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NKD1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NKD1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NKD1 nkd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELVGDVLRDT LSEEEEDDFR LEVALPPEKT DGLGSGDEKK MERVSEPCPG. It is sometimes possible for the material contained within the vial of "NKD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.