WB (Western Blot)
(WB Suggested Anti-NKX3-2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)
Rabbit NKX3-2 Polyclonal Antibody | anti-NKX3-2 antibody
NKX3-2 antibody - N-terminal region
Gene Names
NKX3-2; SMMD; BAPX1; NKX3B; NKX3.2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NKX3-2, Antibody; NKX3-2 antibody - N-terminal region; anti-NKX3-2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCC
Sequence Length
333
Applicable Applications for anti-NKX3-2 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NKX3-2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NKX3-2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-NKX3-2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: NKX3-2Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NKX3-2Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NKX3-2 antibody
This is a rabbit polyclonal antibody against NKX3-2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NKX3-2 is a member of the NK family of homeobox-containing proteins. It may play a role in skeletal development. This gene encodes a member of the NK family of homeobox-containing proteins. The encoded protein may play a role in skeletal development. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1111 BC111966.1 1-1111 1112-2241 AC006445.11 110916-112045
Target Description: NKX3-2 is a member of the NK family of homeobox-containing proteins. It may play a role in skeletal development. This gene encodes a member of the NK family of homeobox-containing proteins. The encoded protein may play a role in skeletal development. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1111 BC111966.1 1-1111 1112-2241 AC006445.11 110916-112045
Product Categories/Family for anti-NKX3-2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
homeobox protein Nkx-3.2
NCBI Official Synonym Full Names
NK3 homeobox 2
NCBI Official Symbol
NKX3-2
NCBI Official Synonym Symbols
SMMD; BAPX1; NKX3B; NKX3.2
NCBI Protein Information
homeobox protein Nkx-3.2
UniProt Protein Name
Homeobox protein Nkx-3.2
UniProt Gene Name
NKX3-2
UniProt Synonym Gene Names
BAPX1; NKX3B
UniProt Entry Name
NKX32_HUMAN
Similar Products
Product Notes
The NKX3-2 nkx3-2 (Catalog #AAA197539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NKX3-2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NKX3-2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NKX3-2 nkx3-2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVRGANTLTS FSIQAILNKK EERGGLAAPE GRPAPGGTAA SVAAAPAVCC. It is sometimes possible for the material contained within the vial of "NKX3-2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.