Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200008_WB13.jpg WB (Western Blot) (WB Suggested Anti-NLGN4X Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Rabbit NLGN4X Polyclonal Antibody | anti-NLGN4X antibody

NLGN4X antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
NLGN4X; HLNX; HNL4X; NLGN4; ASPGX2; AUTSX2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NLGN4X, Antibody; NLGN4X antibody - middle region; anti-NLGN4X antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE
Sequence Length
816
Applicable Applications for anti-NLGN4X antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NLGN4X
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NLGN4X Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

product-image-AAA200008_WB13.jpg WB (Western Blot) (WB Suggested Anti-NLGN4X Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: NLGN4XSample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200008_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: NLGN4XSample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-NLGN4X antibody
This is a rabbit polyclonal antibody against NLGN4X. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene.
Product Categories/Family for anti-NLGN4X antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
neuroligin-4, X-linked
NCBI Official Synonym Full Names
neuroligin 4 X-linked
NCBI Official Symbol
NLGN4X
NCBI Official Synonym Symbols
HLNX; HNL4X; NLGN4; ASPGX2; AUTSX2
NCBI Protein Information
neuroligin-4, X-linked
UniProt Protein Name
Neuroligin-4, Y-linked
UniProt Gene Name
NLGN4Y
UniProt Synonym Gene Names
KIAA0951; Neuroligin Y
UniProt Entry Name
NLGNY_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NLGN4X nlgn4y (Catalog #AAA200008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLGN4X antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NLGN4X can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NLGN4X nlgn4y for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELFSCNFSKN DVMLSAVVMT YWTNFAKTGD PNQPVPQDTK FIHTKPNRFE. It is sometimes possible for the material contained within the vial of "NLGN4X, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.