Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197392_SDS_PAGE10.jpg SDS_PAGE (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. The protein is processed to 40 kDa.)

Rabbit NOCT Polyclonal Antibody | anti-NOCT antibody

NOCT Antibody - N-terminal region

Gene Names
NOCT; NOC; CCR4L; Ccr4c; CCRN4L
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
NOCT, Antibody; NOCT Antibody - N-terminal region; NOC, CCR4L, Ccr4c, CCRN4L; anti-NOCT antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1.0 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD
Sequence Length
431
Applicable Applications for anti-NOCT antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L
Protein Size (# AA)
431 amino acids
Blocking Peptide
For anti-NOCT (MBS3201003) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

SDS_PAGE

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. The protein is processed to 40 kDa.)

product-image-AAA197392_SDS_PAGE10.jpg SDS_PAGE (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. The protein is processed to 40 kDa.)

WB (Western Blot)

(WB Suggested Anti-CCRN4L Antibody Titration: 1.0-2.0ug/mlPositive Control: Daudi cell lysateCCRN4L is supported by BioGPS gene expression data to be expressed in Daudi)

product-image-AAA197392_WB11.jpg WB (Western Blot) (WB Suggested Anti-CCRN4L Antibody Titration: 1.0-2.0ug/mlPositive Control: Daudi cell lysateCCRN4L is supported by BioGPS gene expression data to be expressed in Daudi)

IHC (Immunohiostchemistry)

(Rabbit Anti-CCRN4L antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197392_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-CCRN4L antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human Lung)

product-image-AAA197392_IHC15.jpg IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-NOCT antibody
Target Description: The protein encoded by this gene is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
nocturnin
NCBI Official Synonym Full Names
nocturnin
NCBI Official Symbol
NOCT
NCBI Official Synonym Symbols
NOC; CCR4L; Ccr4c; CCRN4L
NCBI Protein Information
nocturnin
UniProt Protein Name
Nocturnin
UniProt Gene Name
NOCT

Similar Products

Product Notes

The NOCT noct (Catalog #AAA197392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOCT Antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's NOCT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NOCT noct for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNSSAASQHP EYLVSPDPEH LEPIDPKELL EECRAVLHTR PPRFQRDFVD. It is sometimes possible for the material contained within the vial of "NOCT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.