Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224438_WB13.jpg WB (Western Blot) (Western Blot showing NOL5A antibody used at a concentration of 1-2 ug/ml to detect its target protein.)

Rabbit NOL5A Polyclonal Antibody | anti-NOL5A antibody

NOL5A antibody

Average rating 0.0
No ratings yet
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
NOL5A, Antibody; NOL5A antibody; Polyclonal NOL5A; Anti-NOL5A; NOLA-5; NOLA 5; Nucleolar Protein 5A; NOP56; NOL5A; 56Kda With Kke/D Repeat; anti-NOL5A antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOL5A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-NOL5A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. NOL5A is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them have not been determined.
Cross-Reactivity
Human
Immunogen
NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

WB (Western Blot)

(Western Blot showing NOL5A antibody used at a concentration of 1-2 ug/ml to detect its target protein.)

product-image-AAA224438_WB13.jpg WB (Western Blot) (Western Blot showing NOL5A antibody used at a concentration of 1-2 ug/ml to detect its target protein.)

IHC (Immunohistochemistry)

(NOL5A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)

product-image-AAA224438_IHC15.jpg IHC (Immunohistochemistry) (NOL5A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)
Related Product Information for anti-NOL5A antibody
Rabbit polyclonal NOL5A antibody
Product Categories/Family for anti-NOL5A antibody

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NOL5A (Catalog #AAA224438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NOL5A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NOL5A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOL5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.