WB (Western Blot)
(WB Suggested Anti-NOL6 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateNOL6 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit NOL6 Polyclonal Antibody | anti-NOL6 antibody
NOL6 antibody - C-terminal region
Gene Names
NOL6; NRAP; UTP22; bA311H10.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
NOL6, Antibody; NOL6 antibody - C-terminal region; anti-NOL6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG
Sequence Length
200
Applicable Applications for anti-NOL6 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NOL6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NOL6 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateNOL6 is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(WB Suggested Anti-NOL6 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateNOL6 is supported by BioGPS gene expression data to be expressed in HepG2)
IHC (Immunohistochemistry)
(Rabbit Anti-NOL6 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-NOL6 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-NOL6 antibody
This is a rabbit polyclonal antibody against NOL6. It was validated on Western Blot and immunohistochemistry
Target Description: NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts.
Target Description: NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts.
Product Categories/Family for anti-NOL6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
NOL6 protein
NCBI Official Synonym Full Names
nucleolar protein 6
NCBI Official Symbol
NOL6
NCBI Official Synonym Symbols
NRAP; UTP22; bA311H10.1
NCBI Protein Information
nucleolar protein 6
UniProt Protein Name
Nucleolar protein 6
UniProt Gene Name
NOL6
UniProt Synonym Gene Names
Nrap
UniProt Entry Name
NOL6_HUMAN
Similar Products
Product Notes
The NOL6 nol6 (Catalog #AAA198801) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOL6 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NOL6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NOL6 nol6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VIGVLWKPTS FQPQPFKASS TKGRMVMSRG GELVMVPNVE AILEDFAVLG. It is sometimes possible for the material contained within the vial of "NOL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.