WB (Western Blot)
(NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.NOLC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Rabbit NOLC1 Polyclonal Antibody | anti-NOLC1 antibody
NOLC1 antibody - C-terminal region
Gene Names
NOLC1; P130; NOPP130; NOPP140; NS5ATP13
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
NOLC1, Antibody; NOLC1 antibody - C-terminal region; anti-NOLC1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
Sequence Length
699
Applicable Applications for anti-NOLC1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NOLC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.NOLC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
WB (Western Blot)
(NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.NOLC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
IHC (Immunohiostchemistry)
(Immunohistochemistry with pFa fixed zebrafish kidney tissue at an antibody concentration of 0.004 using anti-NOLC1 antibody)
IHC (Immunohiostchemistry)
(Immunohistochemistry with pFa fixed zebrafish kidney tissue at an antibody concentration of 0.004 using anti-NOLC1 antibody)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-NOLC1 antibody
This is a rabbit polyclonal antibody against NOLC1. It was validated on Western Blot and immunohistochemistry
Target Description: Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.
Target Description: Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.
Product Categories/Family for anti-NOLC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
nucleolar and coiled-body phosphoprotein 1 isoform 2
NCBI Official Synonym Full Names
nucleolar and coiled-body phosphoprotein 1
NCBI Official Symbol
NOLC1
NCBI Official Synonym Symbols
P130; NOPP130; NOPP140; NS5ATP13
NCBI Protein Information
nucleolar and coiled-body phosphoprotein 1
UniProt Protein Name
Nucleolar and coiled-body phosphoprotein 1
UniProt Gene Name
NOLC1
UniProt Synonym Gene Names
KIAA0035; NS5ATP13; Nopp140
UniProt Entry Name
NOLC1_HUMAN
Similar Products
Product Notes
The NOLC1 nolc1 (Catalog #AAA199664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOLC1 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NOLC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NOLC1 nolc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DNSFDAKRGA AGDWGERANQ VLKFTKGKSF RHEKTKKKRG SYRGGSISVQ. It is sometimes possible for the material contained within the vial of "NOLC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.