Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198950_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: NOX4Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NOX4 Polyclonal Antibody | anti-NOX4 antibody

NOX4 Antibody - middle region

Gene Names
NOX4; KOX; KOX-1; RENOX
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NOX4, Antibody; NOX4 Antibody - middle region; anti-NOX4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSGDDWK
Sequence Length
342
Applicable Applications for anti-NOX4 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NOX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: NOX4Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA198950_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: NOX4Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOX4Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198950_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: NOX4Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOX4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198950_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: NOX4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-NOX4 antibody
This is a rabbit polyclonal antibody against NOX4. It was validated on Western Blot

Target Description: This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-NOX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
NADPH oxidase 4 isoform c
NCBI Official Synonym Full Names
NADPH oxidase 4
NCBI Official Symbol
NOX4
NCBI Official Synonym Symbols
KOX; KOX-1; RENOX
NCBI Protein Information
NADPH oxidase 4
UniProt Protein Name
NADPH oxidase 4
UniProt Gene Name
NOX4
UniProt Synonym Gene Names
RENOX; KOX-1
UniProt Entry Name
NOX4_HUMAN

Similar Products

Product Notes

The NOX4 nox4 (Catalog #AAA198950) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOX4 Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's NOX4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NOX4 nox4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCMVVVLFLM ITASTYAIRV SNYDIFWYTH NLFFVFYMLL TLHVSGDDWK. It is sometimes possible for the material contained within the vial of "NOX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.