WB (Western Blot)
(WB Suggested Anti-Nppc AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Rabbit Nppc Polyclonal Antibody | anti-NPPC antibody
Nppc Antibody - C-terminal region
Gene Names
Nppc; CNP; lbab
Reactivity
Tested Species Reactivity: MousePredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nppc, Antibody; Nppc Antibody - C-terminal region; C, lb, CNP, lbab; anti-NPPC antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Mouse
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS
Sequence Length
126
Applicable Applications for anti-NPPC antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Nppc
Protein Size (# AA)
126 amino acids
Protein Interactions
Npr2;
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Nppc AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
WB (Western Blot)
(WB Suggested Anti-Nppc AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-NPPC antibody
Target Description: This gene encodes a member of the natriuretic peptide family. Natriuretic peptides are involved in the control of blood pressure, extracellular fluid volume and electrolyte homeostasis. The encoded protein also plays a role in sensory neuron bifurcation, and is a critical regulator of endochondral bone growth. The encoded protein is a ligand for the natriuretic peptide receptor B, and is synthesized as a preprohormone which is cleaved to produce a mature peptide. Mutations in this gene are associated with dwarfism resulting from impaired endochondral ossification.
Product Categories/Family for anti-NPPC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
C-type natriuretic peptide preproprotein
NCBI Official Synonym Full Names
natriuretic peptide type C
NCBI Official Symbol
Nppc
NCBI Official Synonym Symbols
CNP; lbab
NCBI Protein Information
C-type natriuretic peptide
UniProt Protein Name
C-type natriuretic peptide
UniProt Gene Name
Nppc
UniProt Synonym Gene Names
Cnp
UniProt Entry Name
ANFC_MOUSE
Similar Products
Product Notes
The NPPC nppc (Catalog #AAA200719) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nppc Antibody - C-terminal region reacts with Tested Species Reactivity: Mouse Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Nppc can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NPPC nppc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLRDLRVDTK SRAAWARLLH EHPNARKYKG GNKKGLSKGC FGLKLDRIGS. It is sometimes possible for the material contained within the vial of "Nppc, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.