Rabbit NPTXR Polyclonal Antibody | anti-NPTXR antibody
NPTXR Antibody - middle region
Gene Names
Nptxr; NPR; Npcd; AI452369; AI785356; D15Bwg0580e; 1200009K17Rik; 1700036C17Rik; 5730406O18Rik
Reactivity
Tested Reactivity: MousePredicted Reactivity: Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
NPTXR, Antibody; NPTXR Antibody - middle region; anti-NPTXR antibody
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Mouse
Predicted Reactivity: Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Applicable Applications for anti-NPTXR antibody
WB (Western Blot)
Protein Size (# AA)
493 amino acids
Blocking Peptide
For anti-NPTXR (MBS3223782) antibody is Catalog #
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse NPTXR
Peptide Sequence
Synthetic peptide located within the following region: VAQLPLSLKDSNWHHICISWTTRDGLWSAYQDGELRGSGENLAAWHPIKP
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-NPTXR antibody
This gene encodes a protein similar to the rat neuronal pentraxin receptor. The rat pentraxin receptor is an integral membrane protein that is thought to mediate neuronal uptake of the snake venom toxin, taipoxin, and its transport into the synapses. Studies in rat indicate that translation of this mRNA initiates at a non-AUG (CUG) codon. This may also be true for mouse and human, based on strong sequence conservation amongst these species.
Product Categories/Family for anti-NPTXR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
Neuronal pentraxin receptor
NCBI Official Synonym Full Names
neuronal pentraxin receptor
NCBI Official Symbol
Nptxr
NCBI Official Synonym Symbols
NPR; Npcd; AI452369; AI785356; D15Bwg0580e; 1200009K17Rik; 1700036C17Rik; 5730406O18Rik
NCBI Protein Information
neuronal pentraxin receptor
UniProt Protein Name
Neuronal pentraxin receptor
UniProt Gene Name
Nptxr
UniProt Synonym Gene Names
Npr
UniProt Entry Name
NPTXR_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The NPTXR nptxr (Catalog #AAA201629) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPTXR Antibody - middle region reacts with Tested Reactivity: Mouse Predicted Reactivity: Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NPTXR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NPTXR nptxr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NPTXR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
