Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282208_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using NR1H2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit anti-Human NR1H2 Polyclonal Antibody | anti-NR1H2 antibody

NR1H2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TTF1; TTF-1; TTF-I
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
NR1H2, Antibody; NR1H2 Rabbit pAb; NR1H2; LXR-b; LXRB; NER; NER-I; RIP15; UNR; oxysterols receptor LXR-beta; anti-NR1H2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
RLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLEKMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQGRWII
Applicable Applications for anti-NR1H2 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
A-431
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NR1H2 (NP_009052.4).
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using NR1H2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282208_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using NR1H2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of A-431 cells, using NR1H2 antibody at 1:440 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)

product-image-AAA282208_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of A-431 cells, using NR1H2 antibody at 1:440 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Related Product Information for anti-NR1H2 antibody
The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).[supplied by OMIM, Jan 2010]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
transcription termination factor 1 isoform 2
NCBI Official Synonym Full Names
transcription termination factor, RNA polymerase I
NCBI Official Symbol
TTF1
NCBI Official Synonym Symbols
TTF-1; TTF-I
NCBI Protein Information
transcription termination factor 1
UniProt Protein Name
Transcription termination factor 1
UniProt Gene Name
TTF1
UniProt Synonym Gene Names
TTF-1; TTF-I

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NR1H2 ttf1 (Catalog #AAA282208) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR1H2 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR1H2 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the NR1H2 ttf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RLKAVYVPFW QKKTFPEIID YLYETTLPLL KEKLEKMMEK KGTKIQTPAA PKQVFPFRDI FYYEDDSEGE DIEKESEGQA PCMAHACNSS TLGGQGRWII. It is sometimes possible for the material contained within the vial of "NR1H2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.