Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23452_WB6.jpg WB (Western Blot) (WB Suggested Anti-NR1I2 antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit anti-Human NR1I2 Polyclonal Antibody | anti-NR1I2 antibody

NR1I2 antibody - N-terminal region

Gene Names
NR1I2; BXR; PAR; PRR; PXR; SAR; SXR; ONR1; PAR1; PAR2; PARq
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NR1I2, Antibody; NR1I2 antibody - N-terminal region; anti-NR1I2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA
Sequence Length
434
Applicable Applications for anti-NR1I2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NR1I2 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA23452_WB6.jpg WB (Western Blot) (WB Suggested Anti-NR1I2 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-NR1I2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

product-image-AAA23452_WB5.jpg WB (Western Blot) (WB Suggested Anti-NR1I2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: NR1I2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23452_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: NR1I2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NR1I2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23452_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: NR1I2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23452_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Small Intestine tissue at an antibody concentration of 5.0ug/ml using anti-NR1I2 antibody)

product-image-AAA23452_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Small Intestine tissue at an antibody concentration of 5.0ug/ml using anti-NR1I2 antibody)
Related Product Information for anti-NR1I2 antibody
This is a rabbit polyclonal antibody against NR1I2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. NR1I2 contains a zinc finger domain.NR1I2 is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
nuclear receptor subfamily 1 group I member 2 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 1 group I member 2
NCBI Official Symbol
NR1I2
NCBI Official Synonym Symbols
BXR; PAR; PRR; PXR; SAR; SXR; ONR1; PAR1; PAR2; PARq
NCBI Protein Information
nuclear receptor subfamily 1 group I member 2
UniProt Protein Name
Nuclear receptor subfamily 1 group I member 2
UniProt Gene Name
NR1I2
UniProt Synonym Gene Names
PXR; SXR
UniProt Entry Name
NR1I2_HUMAN

Similar Products

Product Notes

The NR1I2 nr1i2 (Catalog #AAA23452) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR1I2 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR1I2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NR1I2 nr1i2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKEMIMSDEA VEERRALIKR KKSERTGTQP LGVQGLTEEQ RMMIRELMDA. It is sometimes possible for the material contained within the vial of "NR1I2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.