Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23403_WB7.jpg WB (Western Blot) (WB Suggested Anti-NR2E1 Antibody Titration: 1 ug/mlPositive Control: Fetal Muscle cell lysate)

Rabbit NR2E1 Polyclonal Antibody | anti-NR2E1 antibody

NR2E1 antibody - N-terminal region

Gene Names
NR2E1; TLL; TLX; XTLL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NR2E1, Antibody; NR2E1 antibody - N-terminal region; anti-NR2E1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY
Sequence Length
385
Applicable Applications for anti-NR2E1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC Information: Colon, myenteric plexus
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NR2E1 Antibody Titration: 1 ug/mlPositive Control: Fetal Muscle cell lysate)

product-image-AAA23403_WB7.jpg WB (Western Blot) (WB Suggested Anti-NR2E1 Antibody Titration: 1 ug/mlPositive Control: Fetal Muscle cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: NR2E1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23403_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: NR2E1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NR2E1Sample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23403_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: NR2E1Sample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NR2E1Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

product-image-AAA23403_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: NR2E1Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human Prostate)

product-image-AAA23403_IHC3.jpg IHC (Immunohistochemistry) (Human Prostate)

IHC (Immunohistochemistry)

(Human Placenta)

product-image-AAA23403_IHC2.jpg IHC (Immunohistochemistry) (Human Placenta)

IHC (Immunohistochemistry)

(Human Brain)

product-image-AAA23403_IHC.jpg IHC (Immunohistochemistry) (Human Brain)
Related Product Information for anti-NR2E1 antibody
This is a rabbit polyclonal antibody against NR2E1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
nuclear receptor subfamily 2 group E member 1 isoform b
NCBI Official Synonym Full Names
nuclear receptor subfamily 2 group E member 1
NCBI Official Symbol
NR2E1
NCBI Official Synonym Symbols
TLL; TLX; XTLL
NCBI Protein Information
nuclear receptor subfamily 2 group E member 1
UniProt Protein Name
Nuclear receptor subfamily 2 group E member 1
UniProt Gene Name
NR2E1
UniProt Synonym Gene Names
TLX; Tll; hTll
UniProt Entry Name
NR2E1_HUMAN

Similar Products

Product Notes

The NR2E1 nr2e1 (Catalog #AAA23403) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR2E1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NR2E1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). IHC Information: Colon, myenteric plexus. Researchers should empirically determine the suitability of the NR2E1 nr2e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSKPAGSTSR ILDIPCKVCG DRSSGKHYGV YACDGCSGFF KRSIRRNRTY. It is sometimes possible for the material contained within the vial of "NR2E1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.