Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197133_WB13.jpg WB (Western Blot) (WB Suggested Anti-NR3C1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit NR3C1 Polyclonal Antibody | anti-NR3C1 antibody

NR3C1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
NR3C1; GR; GCR; GRL; GCCR; GCRST
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NR3C1, Antibody; NR3C1 antibody - N-terminal region; anti-NR3C1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAV
Sequence Length
777
Applicable Applications for anti-NR3C1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 79%; Rabbit: 86%; Rat: 86%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR3C1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NR3C1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

product-image-AAA197133_WB13.jpg WB (Western Blot) (WB Suggested Anti-NR3C1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

IHC (Immunohistochemistry)

(Rabbit Anti-NR3C1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197133_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-NR3C1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-NR3C1 antibody
This is a rabbit polyclonal antibody against NR3C1. It was validated on Western Blot

Target Description: NR3C1 is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
glucocorticoid receptor isoform alpha
NCBI Official Synonym Full Names
nuclear receptor subfamily 3 group C member 1
NCBI Official Symbol
NR3C1
NCBI Official Synonym Symbols
GR; GCR; GRL; GCCR; GCRST
NCBI Protein Information
glucocorticoid receptor
UniProt Protein Name
Glucocorticoid receptor
UniProt Gene Name
NR3C1
UniProt Synonym Gene Names
GRL; GR
UniProt Entry Name
GCR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NR3C1 nr3c1 (Catalog #AAA197133) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR3C1 antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's NR3C1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NR3C1 nr3c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDSKESLTPG REENPSSVLA QERGDVMDFY KTLRGGATVK VSASSPSLAV. It is sometimes possible for the material contained within the vial of "NR3C1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.