WB (Western Blot)
(WB Suggested Anti-NSF Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Rabbit NSF Polyclonal Antibody | anti-NSF antibody
NSF antibody - C-terminal region
Gene Names
NSF; SKD2; SEC18
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NSF, Antibody; NSF antibody - C-terminal region; anti-NSF antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL
Sequence Length
744
Applicable Applications for anti-NSF antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NSF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NSF Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
WB (Western Blot)
(WB Suggested Anti-NSF Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
WB (Western Blot)
(Sample Type: Mouse BrainSample Type: 1. NT-2 cells2. mouse brain extractsPrimary Antibody Dilution: 2ug/mlSecondary Antibody Dilution: 1: 20,000Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceLane 1: 60ug/laneLane 2: 80ug/laneImage Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science )
WB (Western Blot)
(Sample Type: Mouse BrainSample Type: 1. NT-2 cells2. mouse brain extractsPrimary Antibody Dilution: 2ug/mlSecondary Antibody Dilution: 1: 20,000Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceLane 1: 60ug/laneLane 2: 80ug/laneImage Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science )
IHC (Immunohistochemistry)
(Sample Type :Mouse brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :NSF: Red DAPI:BlueGene Name :NSFSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
IHC (Immunohistochemistry)
(Sample Type :Mouse brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :NSF: Red DAPI:BlueGene Name :NSFSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-NSF antibody
This is a rabbit polyclonal antibody against NSF. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The functions of NSF remain unknown.
Target Description: The functions of NSF remain unknown.
Product Categories/Family for anti-NSF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Synonym Full Names
N-ethylmaleimide sensitive factor, vesicle fusing ATPase
NCBI Official Symbol
NSF
NCBI Official Synonym Symbols
SKD2; SEC18
NCBI Protein Information
vesicle-fusing ATPase
UniProt Protein Name
Vesicle-fusing ATPase
UniProt Gene Name
NSF
UniProt Synonym Gene Names
NEM-sensitive fusion protein
UniProt Entry Name
NSF_HUMAN
Similar Products
Product Notes
The NSF nsf (Catalog #AAA198723) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NSF antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NSF can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NSF nsf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STTIHVPNIA TGEQLLEALE LLGNFKDKER TTIAQQVKGK KVWIGIKKLL. It is sometimes possible for the material contained within the vial of "NSF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.