Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198442_WB13.jpg WB (Western Blot) (WB Suggested Anti-NT5C AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellNT5C is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Human NT5C Polyclonal Antibody | anti-NT5C antibody

NT5C antibody - C-terminal region

Gene Names
NT5C; DNT; cdN; DNT1; P5N2; PN-I; HEL74; PN-II; UMPH2; dNT-1
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NT5C, Antibody; NT5C antibody - C-terminal region; anti-NT5C antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
Sequence Length
201
Applicable Applications for anti-NT5C antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NT5C AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellNT5C is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA198442_WB13.jpg WB (Western Blot) (WB Suggested Anti-NT5C AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellNT5C is supported by BioGPS gene expression data to be expressed in 721_B)

IHC (Immunohistochemistry)

(Rabbit Anti-NT5C antibodyParaffin Embedded Tissue: Human Placenta cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198442_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-NT5C antibodyParaffin Embedded Tissue: Human Placenta cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-NT5C antibody
This is a rabbit polyclonal antibody against NT5C. It was validated on Western Blot

Target Description: This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-NT5C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
5'(3')-deoxyribonucleotidase, cytosolic type isoform 1
NCBI Official Synonym Full Names
5', 3'-nucleotidase, cytosolic
NCBI Official Symbol
NT5C
NCBI Official Synonym Symbols
DNT; cdN; DNT1; P5N2; PN-I; HEL74; PN-II; UMPH2; dNT-1
NCBI Protein Information
5'(3')-deoxyribonucleotidase, cytosolic type
UniProt Protein Name
5'(3')-deoxyribonucleotidase, cytosolic type
UniProt Gene Name
NT5C
UniProt Synonym Gene Names
DNT1; UMPH2; dNT-1
UniProt Entry Name
NT5C_HUMAN

Similar Products

Product Notes

The NT5C nt5c (Catalog #AAA198442) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NT5C antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NT5C can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NT5C nt5c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEETPSWEHI LFTCCHNRHL VLPPTRRRLL SWSDNWREIL DSKRGAAQRE. It is sometimes possible for the material contained within the vial of "NT5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.