Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282263_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse lung, using NUCKS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

Rabbit NUCKS1 Polyclonal Antibody | anti-NUCKS1 antibody

NUCKS1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
H2AFY; H2A.y; H2A/y; mH2A1; H2AF12M; MACROH2A1.1; macroH2A1.2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
NUCKS1, Antibody; NUCKS1 Rabbit pAb; JC7; NUCKS; anti-NUCKS1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
IHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL
Applicable Applications for anti-NUCKS1 antibody
WB (Western Blot)
Positive Samples
U-251MG, HepG2, HeLa, Rat brain, Mouse lung
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2).
Cellular Location
cytoplasm, nucleolus, nucleoplasm, nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of Mouse lung, using NUCKS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

product-image-AAA282263_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse lung, using NUCKS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using NUCKS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)

product-image-AAA282263_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NUCKS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Related Product Information for anti-NUCKS1 antibody
This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated in vivo by Cdk1 during mitosis of the cell cycle.
Product Categories/Family for anti-NUCKS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,489 Da
NCBI Official Full Name
core histone macro-H2A.1 isoform 2
NCBI Official Synonym Full Names
H2A histone family member Y
NCBI Official Symbol
H2AFY
NCBI Official Synonym Symbols
H2A.y; H2A/y; mH2A1; H2AF12M; MACROH2A1.1; macroH2A1.2
NCBI Protein Information
core histone macro-H2A.1
UniProt Protein Name
Core histone macro-H2A.1
UniProt Gene Name
H2AFY
UniProt Synonym Gene Names
MACROH2A1; Histone macroH2A1; mH2A1; H2A/y

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NUCKS1 h2afy (Catalog #AAA282263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUCKS1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NUCKS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NUCKS1 h2afy for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IHSEISNLAG FEVEAIINPT NADIDLKDDL GNTLEKKGGK EFVEAVLELR KKNGPLEVAG AAVSAGHGLP AKFVIHCNSP VWGADKCEEL LEKTVKNCLA L. It is sometimes possible for the material contained within the vial of "NUCKS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.