WB (Western Blot)
(Nucleobindin 2 antibody (AAA224252) used at 1.25 ug/ml to detect target protein.)
Rabbit Nucleobindin 2 Polyclonal Antibody | anti-NUCB2 antibody
Nucleobindin 2 antibody
Gene Names
NUCB2; NEFA; HEL-S-109
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
Nucleobindin 2, Antibody; Nucleobindin 2 antibody; Polyclonal Nucleobindin 2; Anti-Nucleobindin 2; Nucleobindin -2; Nucleobindin 2; NUCB2; anti-NUCB2 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
Nucleobindin 2 antibody was raised against the middle region of NUCB2
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NUCB2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
420
Applicable Applications for anti-NUCB2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
Nucleobindin-2 is a calcium-binding EF-hand protein.
Cross-Reactivity
Human
Immunogen
Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
WB (Western Blot)
(Nucleobindin 2 antibody (AAA224252) used at 1.25 ug/ml to detect target protein.)
WB (Western Blot)
(Nucleobindin 2 antibody (AAA224252) used at 1.25 ug/ml to detect target protein.)
IHC (Immunohistochemistry)
(Nucleobindin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X)
IHC (Immunohistochemistry)
(Nucleobindin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X)
Related Product Information for anti-NUCB2 antibody
Rabbit polyclonal Nucleobindin 2 antibody raised against the middle region of NUCB2
Product Categories/Family for anti-NUCB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46 kDa (MW of target protein)
NCBI Official Full Name
nucleobindin-2
NCBI Official Synonym Full Names
nucleobindin 2
NCBI Official Symbol
NUCB2
NCBI Official Synonym Symbols
NEFA; HEL-S-109
NCBI Protein Information
nucleobindin-2
UniProt Protein Name
Nucleobindin-2
UniProt Gene Name
NUCB2
UniProt Synonym Gene Names
NEFA
UniProt Entry Name
NUCB2_HUMAN
Similar Products
Product Notes
The NUCB2 nucb2 (Catalog #AAA224252) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Nucleobindin 2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NUCB2 nucb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Nucleobindin 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.