WB (Western Blot)
(WB Suggested Anti-NUDT7 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Rabbit NUDT7 Polyclonal Antibody | anti-NUDT7 antibody
NUDT7 Antibody - N-terminal region
Reactivity
Predicted: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, RabbitTested: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUDT7, Antibody; NUDT7 Antibody - N-terminal region; anti-NUDT7 antibody
Host
Rabbit
Reactivity
Predicted: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Tested: Human
Tested: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVC
Sequence Length
238
Applicable Applications for anti-NUDT7 antibody
WB (Western Blot)
Protein Size (# AA)
238 amino acids
Protein Interactions
PEX5; CUL1;
Homology
Cow: 100%; Dog: 100%; Goat: 85%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT7
Blocking Peptide
For anti-NUDT7 antibody is Catalog# .
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NUDT7 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
WB (Western Blot)
(WB Suggested Anti-NUDT7 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-NUDT7 antibody
This is a rabbit polyclonal antibody against NUDT7. It was validated on Western Blot
Target Description: The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.
Target Description: The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.
Product Categories/Family for anti-NUDT7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
peroxisomal coenzyme A diphosphatase NUDT7 isoform 1
NCBI Official Synonym Full Names
nudix hydrolase 7
NCBI Official Symbol
NUDT7
NCBI Protein Information
peroxisomal coenzyme A diphosphatase NUDT7
UniProt Protein Name
Peroxisomal coenzyme A diphosphatase NUDT7
UniProt Gene Name
NUDT7
UniProt Synonym Gene Names
Nudix motif 7
Similar Products
Product Notes
The NUDT7 nudt7 (Catalog #AAA201364) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT7 Antibody - N-terminal region reacts with Predicted: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit Tested: Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NUDT7 nudt7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRSEKLRRAP GEVCFPGGKR DPTDMDDAAT ALREAQEEVG LRPHQVEVVC. It is sometimes possible for the material contained within the vial of "NUDT7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.