<
WB (Western Blot)
(WB Suggested Anti-NXF5 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Rabbit NXF5 Polyclonal Antibody | anti-NXF5 antibody
NXF5 antibody - middle region
Reactivity
Dog, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
NXF5, Antibody; NXF5 antibody - middle region; anti-NXF5 antibody
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
Sequence Length
397
Applicable Applications for anti-NXF5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NXF5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NXF5 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-NXF5 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(Lanes:Lane 1: 7ug HeLa cystosolic extractLane 2: 7ug HeLa nuclear extractPrimary Antibody Dilution:1:100Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:NXF5Submitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University)
WB (Western Blot)
(Lanes:Lane 1: 7ug HeLa cystosolic extractLane 2: 7ug HeLa nuclear extractPrimary Antibody Dilution:1:100Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:NXF5Submitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University)
IHC (Immunohiostchemistry)
(Rabbit Anti-NXF5 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohiostchemistry)
(Rabbit Anti-NXF5 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-NXF5 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-NXF5 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-NXF5 antibody
This is a rabbit polyclonal antibody against NXF5. It was validated on Western Blot and immunohistochemistry
Target Description: NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for this gene.
Target Description: NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for this gene.
Product Categories/Family for anti-NXF5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
nuclear RNA export factor 5
NCBI Official Synonym Full Names
nuclear RNA export factor 5
NCBI Official Symbol
NXF5
NCBI Protein Information
nuclear RNA export factor 5
UniProt Protein Name
Nuclear RNA export factor 5
UniProt Gene Name
NXF5
UniProt Synonym Gene Names
TAPL1; TAPL-1
UniProt Entry Name
NXF5_HUMAN
Similar Products
Product Notes
The NXF5 nxf5 (Catalog #AAA198818) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NXF5 antibody - middle region reacts with Dog, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NXF5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NXF5 nxf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITERNFPELL SLNLCNNKLY QLDGLSDITE KAPKVKTLNL SKNKLESAWE. It is sometimes possible for the material contained within the vial of "NXF5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.