Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282369_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded mouse spleen using NXPH4 Rabbit pAb (AAA282369) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Rabbit anti-Human, Mouse NXPH4 Polyclonal Antibody | anti-NXPH4 antibody

NXPH4 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
NXPH4; NPH4
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
NXPH4, Antibody; NXPH4 Rabbit pAb; NPH4; anti-NXPH4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
QIPESGRPQYLGLRPAAAGAGAPGQQLPEPRSSDGLGVGRAWSWAWPTNHTGALARAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKFSLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPVPHPLQSTLALEGVLPGLGPPLGMAAAAAGPGLGGSLGGALAGPLGGALGVPG
Applicable Applications for anti-NXPH4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Positive Samples
A-549, HUVEC
Cellular Location
extracellular region
Research Area
Neuroscience
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 24-224 of human NXPH4 (NP_009155.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded mouse spleen using NXPH4 Rabbit pAb (AAA282369) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282369_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded mouse spleen using NXPH4 Rabbit pAb (AAA282369) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using NXPH4 antibody (AAA282369) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

product-image-AAA282369_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NXPH4 antibody (AAA282369) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)
Related Product Information for anti-NXPH4 antibody
Predicted to enable signaling receptor binding activity. Predicted to be located in extracellular region.
Product Categories/Family for anti-NXPH4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,065 Da
NCBI Official Full Name
neurexophilin-4
NCBI Official Synonym Full Names
neurexophilin 4
NCBI Official Symbol
NXPH4
NCBI Official Synonym Symbols
NPH4
NCBI Protein Information
neurexophilin-4
UniProt Protein Name
Neurexophilin-4
UniProt Gene Name
NXPH4
UniProt Synonym Gene Names
NPH4
UniProt Entry Name
NXPH4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NXPH4 nxph4 (Catalog #AAA282369) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NXPH4 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NXPH4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NXPH4 nxph4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QIPESGRPQY LGLRPAAAGA GAPGQQLPEP RSSDGLGVGR AWSWAWPTNH TGALARAGAA GALPAQRTKR KPSIKAARAK KIFGWGDFYF RVHTLKFSLL VTGKIVDHVN GTFSVYFRHN SSSLGNLSVS IVPPSKRVEF GGVWLPGPVP HPLQSTLALE GVLPGLGPPL GMAAAAAGPG LGGSLGGALA GPLGGALGVP G. It is sometimes possible for the material contained within the vial of "NXPH4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.