Rabbit OAF Polyclonal Antibody | anti-OAF antibody
OAF Antibody - N-terminal region
Gene Names
OAF; NS5ATP13TP2
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Purity
Affinity Purified
Synonyms
OAF, Antibody; OAF Antibody - N-terminal region; anti-OAF antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
PLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSF
Protein Size (# AA)
273 amino acids
Blocking Peptide
For anti-OAF (MBS3216163) antibody is Catalog # MBS3241063
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human OAF
Replacement Item
This antibody may replace item sc-138492 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-OAF antibody
This is a rabbit polyclonal antibody against OAF. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-OAF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
out at first protein homolog
NCBI Official Synonym Full Names
out at first homolog
NCBI Official Symbol
OAF
NCBI Official Synonym Symbols
NS5ATP13TP2
NCBI Protein Information
out at first protein homolog
UniProt Protein Name
Out at first protein homolog
UniProt Gene Name
OAF
UniProt Synonym Gene Names
NS5ATP13TP2
UniProt Entry Name
OAF_HUMAN
Similar Products
Product Notes
The OAF oaf (Catalog #AAA201238) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OAF Antibody - N-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: PLLGTGAPAE LRVRVRLPDG QVTEESLQAD SDADSISLEL RKPDGTLVSF. It is sometimes possible for the material contained within the vial of "OAF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
