Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201643_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: OLFR187Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)

Rabbit OLFR187 Polyclonal Antibody | anti-OLFR187 antibody

OLFR187 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
Olfr187; MOR183-8
Reactivity
Tested: Mouse; Predicted: Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
OLFR187, Antibody; OLFR187 Antibody - C-terminal region; anti-OLFR187 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Mouse; Predicted: Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSLAKFLKRNV
Sequence Length
308
Applicable Applications for anti-OLFR187 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR187
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: OLFR187Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201643_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: OLFR187Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-OLFR187 antibody
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
Olfactory receptor 187
NCBI Official Synonym Full Names
olfactory receptor 187
NCBI Official Symbol
Olfr187
NCBI Official Synonym Symbols
MOR183-8
NCBI Protein Information
olfactory receptor 187
UniProt Protein Name
Olfactory receptor 187
UniProt Gene Name
Olfr187
UniProt Synonym Gene Names
Mor183-8
UniProt Entry Name
OL187_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The OLFR187 olfr187 (Catalog #AAA201643) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OLFR187 Antibody - C-terminal region reacts with Tested: Mouse; Predicted: Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's OLFR187 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OLFR187 olfr187 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VHPASSEVDD QDMIDSLFYT VIIPVLNPII YSLRNKQVID SLAKFLKRNV. It is sometimes possible for the material contained within the vial of "OLFR187, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.