Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200965_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: OPN1MWSample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit OPN1LW Polyclonal Antibody | anti-OPN1LW antibody

OPN1LW Antibody - C-terminal region

Gene Names
OPN1LW; CBP; RCP; ROP; CBBM; COD5
Reactivity
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OPN1LW, Antibody; OPN1LW Antibody - C-terminal region; OPN1LW, OPN1MW, OPN1MW2, OPN1MW3, RCP; anti-OPN1LW antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer and 0.09% sodium azide.
Concentration
0.5mg/mL (varies by lot)
Applicable Applications for anti-OPN1LW antibody
WB (Western Blot)
Protein Size (# AA)
364 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human OPN1MW.
Predicted Homology based on Immunogen Sequence
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide Sequence
Synthetic peptide located within the following region: SIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWG
Blocking Peptide
For anti-OPN1LW (MBS3214494) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: OPN1MWSample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA200965_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: OPN1MWSample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: OPN1MWSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA200965_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: OPN1MWSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-OPN1LW antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
red pigment protein
NCBI Official Synonym Full Names
opsin 1, long wave sensitive
NCBI Official Symbol
OPN1LW
NCBI Official Synonym Symbols
CBP; RCP; ROP; CBBM; COD5
NCBI Protein Information
long-wave-sensitive opsin 1
UniProt Protein Name
Long-wave-sensitive opsin 1
UniProt Gene Name
OPN1LW
UniProt Synonym Gene Names
RCP; ROP
UniProt Entry Name
OPSR_HUMAN

Similar Products

Product Notes

The OPN1LW opn1lw (Catalog #AAA200965) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OPN1LW Antibody - C-terminal region reacts with Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's OPN1LW can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OPN1LW opn1lw for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OPN1LW, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.