Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200945_WB11.jpg WB (Western Blot) (WB Suggested Anti-OPRL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit OPRL1 Polyclonal Antibody | anti-OPRL1 antibody

OPRL1 antibody - middle region

Gene Names
OPRL1; NOP; OOR; NOPr; ORL1; KOR-3; NOCIR
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OPRL1, Antibody; OPRL1 antibody - middle region; anti-OPRL1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ
Sequence Length
370
Applicable Applications for anti-OPRL1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OPRL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-OPRL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA200945_WB11.jpg WB (Western Blot) (WB Suggested Anti-OPRL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlOPRL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA200945_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlOPRL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: OPRL1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA200945_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: OPRL1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-OPRL1 antibody
This is a rabbit polyclonal antibody against OPRL1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17 aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Three transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-OPRL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
nociceptin receptor isoform 1
NCBI Official Synonym Full Names
opioid related nociceptin receptor 1
NCBI Official Symbol
OPRL1
NCBI Official Synonym Symbols
NOP; OOR; NOPr; ORL1; KOR-3; NOCIR
NCBI Protein Information
nociceptin receptor
UniProt Protein Name
Nociceptin receptor
UniProt Gene Name
OPRL1
UniProt Synonym Gene Names
KOR-3
UniProt Entry Name
OPRX_PIG

Similar Products

Product Notes

The OPRL1 oprl1 (Catalog #AAA200945) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OPRL1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OPRL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OPRL1 oprl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISVCYSLMIR RLRGVRLLSG SREKDRNLRR ITRLVLVVVA VFVGCWTPVQ. It is sometimes possible for the material contained within the vial of "OPRL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.