Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281744_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using OR10H3 antibody at dilution of 1:100 (40x lens).)

Rabbit OR10H3 Polyclonal Antibody | anti-OR10H3 antibody

OR10H3 Rabbit pAb

Gene Names
CHUK; IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
OR10H3, Antibody; OR10H3 Rabbit pAb; OR10H3; anti-OR10H3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MLGLNHTSMSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMYLFLCVLSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQ
Applicable Applications for anti-OR10H3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OR10H3 (NP_039227.1).
Positive Samples
HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using OR10H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281744_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using OR10H3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human oophoroma using OR10H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281744_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human oophoroma using OR10H3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat brain using OR10H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281744_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat brain using OR10H3 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of HepG2 cells, using OR10H3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5min.)

product-image-AAA281744_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of HepG2 cells, using OR10H3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5min.)
Related Product Information for anti-OR10H3 antibody
Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Product Categories/Family for anti-OR10H3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,640 Da
NCBI Official Full Name
inhibitor of nuclear factor kappa-B kinase subunit alpha
NCBI Official Synonym Full Names
conserved helix-loop-helix ubiquitous kinase
NCBI Official Symbol
CHUK
NCBI Official Synonym Symbols
IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
NCBI Protein Information
inhibitor of nuclear factor kappa-B kinase subunit alpha; TCF-16; IKK-a kinase; I-kappa-B kinase 1; I-kappa-B kinase-alpha; transcription factor 16; IkB kinase alpha subunit; Nuclear factor NFkappaB inhibitor kinase alpha
UniProt Protein Name
Inhibitor of nuclear factor kappa-B kinase subunit alpha
UniProt Gene Name
CHUK
UniProt Synonym Gene Names
IKKA; TCF16; I-kappa-B kinase alpha; IKK-A; IKK-alpha; IkBKA; IkappaB kinase; IKK1; NFKBIKA; TCF-16
UniProt Entry Name
IKKA_HUMAN

Similar Products

Product Notes

The OR10H3 chuk (Catalog #AAA281744) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OR10H3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OR10H3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the OR10H3 chuk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLGLNHTSMS EFILVGFSAF PHLQLMLFLL FLLMYLFTLL GNLLIMATVW SERSLHTPMY LFLCVLSVSE ILYTVAIIPR MLADLLSTQR SIAFLACASQ. It is sometimes possible for the material contained within the vial of "OR10H3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.