Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197238_WB11.jpg WB (Western Blot) (WB Suggested Anti-OR13C9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit OR13C9 Polyclonal Antibody | anti-OR13C9 antibody

OR13C9 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
OR13C9; OR37L; OR9-13
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
OR13C9, Antibody; OR13C9 antibody - middle region; anti-OR13C9 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR
Sequence Length
318
Applicable Applications for anti-OR13C9 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Pig: 79%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OR13C9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-OR13C9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA197238_WB11.jpg WB (Western Blot) (WB Suggested Anti-OR13C9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

IHC (Immunohiostchemistry)

(Rabbit Anti-OR13C9 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197238_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-OR13C9 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-OR13C9 AntibodyParaffin Embedded Tissue: Human BrainCellular Data: Neural CellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197238_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-OR13C9 AntibodyParaffin Embedded Tissue: Human BrainCellular Data: Neural CellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-OR13C9 antibody
This is a rabbit polyclonal antibody against OR13C9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Product Categories/Family for anti-OR13C9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
olfactory receptor 13C9
NCBI Official Synonym Full Names
olfactory receptor family 13 subfamily C member 9
NCBI Official Symbol
OR13C9
NCBI Official Synonym Symbols
OR37L; OR9-13
NCBI Protein Information
olfactory receptor 13C9
UniProt Protein Name
Olfactory receptor 13C2
UniProt Gene Name
OR13C2
UniProt Entry Name
O13C2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The OR13C9 or13c2 (Catalog #AAA197238) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OR13C9 antibody - middle region reacts with Cow, Dog, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OR13C9 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the OR13C9 or13c2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IFYGTILFMY MKPKSKETLN SDDLDATDKI ISMFYGVMTP MMNPLIYSLR. It is sometimes possible for the material contained within the vial of "OR13C9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.