Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201348_WB15.jpg WB (Western Blot) (WB Suggested Anti-OST4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit OST4 Polyclonal Antibody | anti-OST4 antibody

OST4 Antibody - C-terminal region

Reactivity
Human
Predicted: Dog, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OST4, Antibody; OST4 Antibody - C-terminal region; anti-OST4 antibody
Ordering
Host
Rabbit
Reactivity
Human
Predicted: Dog, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE
Sequence Length
37
Applicable Applications for anti-OST4 antibody
WB (Western Blot)
Predicted Homology
Dog: 83%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Subunit
4
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OST4
Blocking Peptide
( )
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-OST4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

product-image-AAA201348_WB15.jpg WB (Western Blot) (WB Suggested Anti-OST4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-OST4 antibody
Target Description: OST4 may be involved in N-glycosylation through its association with N-oligosaccharyl transferase.
Product Categories/Family for anti-OST4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
4kDa
NCBI Official Full Name
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
NCBI Official Synonym Full Names
oligosaccharyltransferase complex subunit 4, non-catalytic
NCBI Official Symbol
OST4
NCBI Protein Information
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
UniProt Protein Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
UniProt Gene Name
OST4

Similar Products

Product Notes

The OST4 ost4 (Catalog #AAA201348) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OST4 Antibody - C-terminal region reacts with Human Predicted: Dog, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OST4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OST4 ost4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MITDVQLAIF ANMLGVSLFL LVVLYHYVAV NNPKKQE. It is sometimes possible for the material contained within the vial of "OST4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.