WB (Western Blot)
(WB Suggested Anti-OTUD6A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Rabbit anti-Human OTUD6A Polyclonal Antibody | anti-OTUD6A antibody
OTUD6A antibody - N-terminal region
Gene Names
OTUD6A; DUBA2; HSHIN6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OTUD6A, Antibody; OTUD6A antibody - N-terminal region; anti-OTUD6A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER
Sequence Length
288
Applicable Applications for anti-OTUD6A antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OTUD6A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-OTUD6A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
WB (Western Blot)
(WB Suggested Anti-OTUD6A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
WB (Western Blot)
(Human Hela cell line, 15 micrograms per laneUsed at both 1:500 and 1:1000 (in 5% Milk in PBS/0.05% Tween). Primary was incubated for 2hrs at 4 degrees Celsius. Both work, but 1:500 gave a stronger signal.)
WB (Western Blot)
(Human Hela cell line, 15 micrograms per laneUsed at both 1:500 and 1:1000 (in 5% Milk in PBS/0.05% Tween). Primary was incubated for 2hrs at 4 degrees Celsius. Both work, but 1:500 gave a stronger signal.)
Related Product Information for anti-OTUD6A antibody
This is a rabbit polyclonal antibody against OTUD6A. It was validated on Western Blot
Target Description: Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA2 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
Target Description: Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA2 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
Product Categories/Family for anti-OTUD6A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
OTU domain-containing protein 6A
NCBI Official Synonym Full Names
OTU deubiquitinase 6A
NCBI Official Symbol
OTUD6A
NCBI Official Synonym Symbols
DUBA2; HSHIN6
NCBI Protein Information
OTU domain-containing protein 6A
UniProt Protein Name
OTU domain-containing protein 6A
UniProt Gene Name
OTUD6A
UniProt Synonym Gene Names
DUBA2
UniProt Entry Name
OTU6A_HUMAN
Similar Products
Product Notes
The OTUD6A otud6a (Catalog #AAA200917) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTUD6A antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OTUD6A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OTUD6A otud6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEAEMAQKHR QELEKFQDDS SIESVVEDLA KMNLENRPPR SSKAHRKRER. It is sometimes possible for the material contained within the vial of "OTUD6A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.