Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198493_WB13.jpg WB (Western Blot) (WB Suggested Anti-OVOL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

Rabbit OVOL2 Polyclonal Antibody | anti-OVOL2 antibody

OVOL2 antibody - N-terminal region

Gene Names
OVOL2; CHED; CHED1; CHED2; PPCD1; ZNF339; EUROIMAGE566589
Reactivity
Cow, Dog, Horse, Human, Mouse
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
OVOL2, Antibody; OVOL2 antibody - N-terminal region; anti-OVOL2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG
Sequence Length
275
Applicable Applications for anti-OVOL2 antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OVOL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-OVOL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

product-image-AAA198493_WB13.jpg WB (Western Blot) (WB Suggested Anti-OVOL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

IF (Immunofluorescence)

(WB Suggested Anti-GCLM AntibodyTitration: 2.5 ug/mlPositive Control: THP-1 Whole Cell)

product-image-AAA198493_IF15.jpg IF (Immunofluorescence) (WB Suggested Anti-GCLM AntibodyTitration: 2.5 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-OVOL2 antibody
This is a rabbit polyclonal antibody against OVOL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OVOL2 contains 4 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family. It is a DNA-binding protein that binds to the 5'-G[GCT]GGGGG-3' core sequence. Probably acts as a transcription regulator.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
transcription factor Ovo-like 2 isoform 1
NCBI Official Synonym Full Names
ovo like zinc finger 2
NCBI Official Symbol
OVOL2
NCBI Official Synonym Symbols
CHED; CHED1; CHED2; PPCD1; ZNF339; EUROIMAGE566589
NCBI Protein Information
transcription factor Ovo-like 2
UniProt Protein Name
Transcription factor Ovo-like 2
UniProt Gene Name
OVOL2
UniProt Synonym Gene Names
ZNF339; hOvo2
UniProt Entry Name
OVOL2_HUMAN

Similar Products

Product Notes

The OVOL2 ovol2 (Catalog #AAA198493) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OVOL2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's OVOL2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the OVOL2 ovol2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PKVFLVKRRS LGVSVRSWDE LPDEKRADTY IPVGLGRLLH DPPEDCRSDG. It is sometimes possible for the material contained within the vial of "OVOL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.