Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199960_WB13.jpg WB (Western Blot) (WB Suggested Anti-OXCT2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit OXCT2 Polyclonal Antibody | anti-OXCT2 antibody

OXCT2 antibody - middle region

Gene Names
OXCT2; SCOTT; FKSG25
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OXCT2, Antibody; OXCT2 antibody - middle region; anti-OXCT2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
Sequence Length
517
Applicable Applications for anti-OXCT2 antibody
WB (Western Blot)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OXCT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-OXCT2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199960_WB13.jpg WB (Western Blot) (WB Suggested Anti-OXCT2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: OXCT2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199960_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: OXCT2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-OXCT2 antibody
This is a rabbit polyclonal antibody against OXCT2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization. See also OXCT1 (MIM 601424).[supplied by OMIM].
Product Categories/Family for anti-OXCT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
NCBI Official Synonym Full Names
3-oxoacid CoA-transferase 2
NCBI Official Symbol
OXCT2
NCBI Official Synonym Symbols
SCOTT; FKSG25
NCBI Protein Information
succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
UniProt Protein Name
Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
UniProt Gene Name
OXCT2
UniProt Synonym Gene Names
FKSG25; SCOT-t
UniProt Entry Name
SCOT2_HUMAN

Similar Products

Product Notes

The OXCT2 oxct2 (Catalog #AAA199960) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OXCT2 antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OXCT2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OXCT2 oxct2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GIPLLASNFI SPSMTVHLHS ENGILGLGPF PTEDEVDADL INAGKQTVTV. It is sometimes possible for the material contained within the vial of "OXCT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.