WB (Western Blot)
(WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Rabbit P2RX7 Polyclonal Antibody | anti-P2RX7 antibody
P2RX7 antibody - middle region
Gene Names
P2RX7; P2X7
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
P2RX7, Antibody; P2RX7 antibody - middle region; anti-P2RX7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
Sequence Length
595
Applicable Applications for anti-P2RX7 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 79%; Rabbit: 90%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human P2RX7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
WB (Western Blot)
(WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
WB (Western Blot)
(WB Suggested Anti-P2RX7 AntibodyPositive Control: Lane 1: 50ug mock transfected HEK-293Lane 2: 50ug hP2X7 transfected HEK-293Lane 3: 50ug mP2X7 transfected HEK-293Lane 4: 50ug rP2X7 transfected HEK-293Primary Antibody Dilution : 1:625Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Ronald Sluyter, School of Biological Sciences, University of Wollongong)
WB (Western Blot)
(WB Suggested Anti-P2RX7 AntibodyPositive Control: Lane 1: 50ug mock transfected HEK-293Lane 2: 50ug hP2X7 transfected HEK-293Lane 3: 50ug mP2X7 transfected HEK-293Lane 4: 50ug rP2X7 transfected HEK-293Primary Antibody Dilution : 1:625Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Ronald Sluyter, School of Biological Sciences, University of Wollongong)
Related Product Information for anti-P2RX7 antibody
This is a rabbit polyclonal antibody against P2RX7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.
Target Description: The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.
Product Categories/Family for anti-P2RX7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
P2X purinoceptor 7
NCBI Official Synonym Full Names
purinergic receptor P2X 7
NCBI Official Symbol
P2RX7
NCBI Official Synonym Symbols
P2X7
NCBI Protein Information
P2X purinoceptor 7
UniProt Protein Name
P2X purinoceptor 7
UniProt Gene Name
P2RX7
UniProt Synonym Gene Names
P2X7
UniProt Entry Name
P2RX7_HUMAN
Similar Products
Product Notes
The P2RX7 p2rx7 (Catalog #AAA197988) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RX7 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's P2RX7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the P2RX7 p2rx7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKEEIVENGV KKLVHSVFDT ADYTFPLQGN SFFVMTNFLK TEGQEQRLCP. It is sometimes possible for the material contained within the vial of "P2RX7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.