Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201259_WB11.jpg WB (Western Blot) (WB Suggested Anti-P2RY11 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit anti-Human P2RY11 Polyclonal Antibody | anti-P2RY11 antibody

P2RY11 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
P2RY11; P2Y11
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
P2RY11, Antibody; P2RY11 antibody - C-terminal region; anti-P2RY11 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ
Sequence Length
374
Applicable Applications for anti-P2RY11 antibody
WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-P2RY11 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

product-image-AAA201259_WB11.jpg WB (Western Blot) (WB Suggested Anti-P2RY11 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: P2RY11Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA201259_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: P2RY11Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: P2RY11Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA201259_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: P2RY11Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-P2RY11 antibody
This is a rabbit polyclonal antibody against P2RY11. It was validated on Western Blot

Target Description: The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is coupled to the stimulation of the phosphoinositide and adenylyl cyclase pathways and behaves as a selective purinoceptor. Naturally occuring read-through transcripts, resulting from intergenic splicing between this gene and an immediately upstream gene (PPAN, encoding peter pan homolog), have been found. The PPAN-P2RY11 read-through mRNA is ubiquitously expressed and encodes a fusion protein that shares identity with each individual gene product.
Product Categories/Family for anti-P2RY11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
P2Y purinoceptor 11
NCBI Official Synonym Full Names
purinergic receptor P2Y11
NCBI Official Symbol
P2RY11
NCBI Official Synonym Symbols
P2Y11
NCBI Protein Information
P2Y purinoceptor 11
UniProt Protein Name
P2Y purinoceptor 11
UniProt Gene Name
P2RY11
UniProt Synonym Gene Names
P2Y11
UniProt Entry Name
P2Y11_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The P2RY11 p2ry11 (Catalog #AAA201259) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RY11 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's P2RY11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the P2RY11 p2ry11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPSLGCCCRH CPGYRDSWNP EDAKSTGQAL PLNATAAPKP SEPQSRELSQ. It is sometimes possible for the material contained within the vial of "P2RY11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.