Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-P4HB Antibody Titration: 0.5ug/mlPositive Control: HepG2 cell lysateP4HB is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit P4HB Polyclonal Antibody | anti-P4HB antibody

P4HB antibody - N-terminal region

Gene Names
P4HB; DSI; GIT; PDI; PHDB; PDIA1; PO4DB; PO4HB; PROHB; CLCRP1; ERBA2L; P4Hbeta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
P4HB, Antibody; P4HB antibody - N-terminal region; anti-P4HB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV
Sequence Length
508
Applicable Applications for anti-P4HB antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human P4HB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-P4HB Antibody Titration: 0.5ug/mlPositive Control: HepG2 cell lysateP4HB is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot) (WB Suggested Anti-P4HB Antibody Titration: 0.5ug/mlPositive Control: HepG2 cell lysateP4HB is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Host: RabbitTarget Name: P4HBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: P4HBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: P4HBSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: P4HBSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: P4HBSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: P4HBSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: P4HBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: MouseTarget Name: P4HBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human kidney)

IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-P4HB antibody
This is a rabbit polyclonal antibody against P4HB. It was validated on Western Blot and immunohistochemistry

Target Description: P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.This gene encodes the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
protein disulfide-isomerase
NCBI Official Synonym Full Names
prolyl 4-hydroxylase subunit beta
NCBI Official Symbol
P4HB
NCBI Official Synonym Symbols
DSI; GIT; PDI; PHDB; PDIA1; PO4DB; PO4HB; PROHB; CLCRP1; ERBA2L; P4Hbeta
NCBI Protein Information
protein disulfide-isomerase
UniProt Protein Name
Protein disulfide-isomerase
UniProt Gene Name
P4HB
UniProt Synonym Gene Names
ERBA2L; PDI; PDIA1; PO4DB; PDI
UniProt Entry Name
PDIA1_HUMAN

Similar Products

Product Notes

The P4HB p4hb (Catalog #AAA23529) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P4HB antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's P4HB can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the P4HB p4hb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIKFFRNGDT ASPKEYTAGR EADDIVNWLK KRTGPAATTL PDGAAAESLV. It is sometimes possible for the material contained within the vial of "P4HB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.